Lineage for d5yzvc_ (5yzv C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808917Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2809156Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2809157Protein automated matches [190568] (11 species)
    not a true protein
  7. 2809363Species Thermomonospora curvata [TaxId:2020] [419993] (1 PDB entry)
  8. 2809366Domain d5yzvc_: 5yzv C: [415616]
    automated match to d6id1e_

Details for d5yzvc_

PDB Entry: 5yzv (more details), 2.6 Å

PDB Description: biophysical and structural characterization of the thermostable wd40 domain of a prokaryotic protein, thermomonospora curvata pkwa
PDB Compounds: (C:) Probable serine/threonine-protein kinase PkwA

SCOPe Domain Sequences for d5yzvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yzvc_ b.69.4.0 (C:) automated matches {Thermomonospora curvata [TaxId: 2020]}
elneprilttdreavavafspggsllaggsgdklihvwdvasgdelhtleghtdwvrava
fspdgallasgsddatvrlwdvaaaeeravfeghthyvldiafspdgsmvasgsrdgtar
lwnvatgtehavlkghtdyvyavafspdgsmvasgsrdgtirlwdvatgkerdvlqapae
nvvslafspdgsmlvhgsdstvhlwdvasgealhtfeghtdwvravafspdgallasgsd
drtirlwdvaaqeehttleghtepvhsvafhpegttlasasedgtiriwp

SCOPe Domain Coordinates for d5yzvc_:

Click to download the PDB-style file with coordinates for d5yzvc_.
(The format of our PDB-style files is described here.)

Timeline for d5yzvc_:

  • d5yzvc_ is new in SCOPe 2.08-stable