SCOPe 2.08: Domain d1a9xe5: 1a9x E:4128-4402

Lineage for d1a9xe5 (1a9x E:4128-4402)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)

6. Protein Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains [56076] (1 species)
   duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains

7. Species Escherichia coli [TaxId:562] [56077] (10 PDB entries)
   Uniprot P00968

8. Domain d1a9xe5: 1a9x E:4128-4402 [41506]
   Other proteins in same PDB: d1a9xa1, d1a9xa2, d1a9xa3, d1a9xa4, d1a9xb1, d1a9xb2, d1a9xc1, d1a9xc2, d1a9xc3, d1a9xc4, d1a9xd1, d1a9xd2, d1a9xe1, d1a9xe2, d1a9xe3, d1a9xe4, d1a9xf1, d1a9xf2, d1a9xg1, d1a9xg2, d1a9xg3, d1a9xg4, d1a9xh1, d1a9xh2
   complexed with adp, cl, k, mn, net, orn, po4

Details for d1a9xe5

PDB Entry: 1a9x, 1.8 Å

PDB Description: carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis

PDB Compounds: (E:) carbamoyl phosphate synthetase (large chain)

SCOPe Domain Sequences for d1a9xe5:

Sequence; same for both SEQRES and ATOM records:

>d1a9xe5 d.142.1.2 (E:4128-4402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]}
drrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsgggiaynree
feeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdamgihtgds
itvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviemnprvsrs
salaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkiprfnfekf
agandrlttqmksvgevmaigrtqqeslqkalrgl

Timeline for d1a9xe5:

• d1a9xe5 first appeared (with stable ids) in SCOP 1.55
  
• d1a9xe5 appears in SCOPe 2.07