![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) ![]() contains a common phosphate-binding site |
![]() | Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein) |
![]() | Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52338] (10 PDB entries) Uniprot P00968 |
![]() | Domain d1a9xc2: 1a9x C:2936-3073 [31480] Other proteins in same PDB: d1a9xa1, d1a9xa3, d1a9xa4, d1a9xa5, d1a9xa6, d1a9xb1, d1a9xb2, d1a9xc1, d1a9xc3, d1a9xc4, d1a9xc5, d1a9xc6, d1a9xd1, d1a9xd2, d1a9xe1, d1a9xe3, d1a9xe4, d1a9xe5, d1a9xe6, d1a9xf1, d1a9xf2, d1a9xg1, d1a9xg3, d1a9xg4, d1a9xg5, d1a9xg6, d1a9xh1, d1a9xh2 complexed with adp, cl, k, mn, net, orn, po4 |
PDB Entry: 1a9x (more details), 1.8 Å
SCOPe Domain Sequences for d1a9xc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a9xc2 c.24.1.1 (C:2936-3073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli [TaxId: 562]} nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln adatekvisvqemhaqik
Timeline for d1a9xc2:
![]() Domains from other chains: (mouse over for more information) d1a9xa1, d1a9xa2, d1a9xa3, d1a9xa4, d1a9xa5, d1a9xa6, d1a9xb1, d1a9xb2, d1a9xd1, d1a9xd2, d1a9xe1, d1a9xe2, d1a9xe3, d1a9xe4, d1a9xe5, d1a9xe6, d1a9xf1, d1a9xf2, d1a9xg1, d1a9xg2, d1a9xg3, d1a9xg4, d1a9xg5, d1a9xg6, d1a9xh1, d1a9xh2 |