SCOPe 2.08: Domain d1a9xg2: 1a9x G:6936-7073

Lineage for d1a9xg2 (1a9x G:6936-7073)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families)
   contains a common phosphate-binding site

5. Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)

6. Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)

7. Species Escherichia coli [TaxId:562] [52338] (10 PDB entries)
   Uniprot P00968

8. Domain d1a9xg2: 1a9x G:6936-7073 [31482]
   Other proteins in same PDB: d1a9xa1, d1a9xa3, d1a9xa4, d1a9xa5, d1a9xa6, d1a9xb1, d1a9xb2, d1a9xc1, d1a9xc3, d1a9xc4, d1a9xc5, d1a9xc6, d1a9xd1, d1a9xd2, d1a9xe1, d1a9xe3, d1a9xe4, d1a9xe5, d1a9xe6, d1a9xf1, d1a9xf2, d1a9xg1, d1a9xg3, d1a9xg4, d1a9xg5, d1a9xg6, d1a9xh1, d1a9xh2
   complexed with adp, cl, k, mn, net, orn, po4

Details for d1a9xg2

PDB Entry: 1a9x, 1.8 Å

PDB Description: carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis

PDB Compounds: (G:) carbamoyl phosphate synthetase (large chain)

SCOPe Domain Sequences for d1a9xg2:

Sequence; same for both SEQRES and ATOM records:

>d1a9xg2 c.24.1.1 (G:6936-7073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli [TaxId: 562]}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik

Timeline for d1a9xg2:

• d1a9xg2 first appeared (with stable ids) in SCOP 1.55
  
• d1a9xg2 appears in SCOPe 2.07