SCOPe 2.08: Domain d5jvrb_: 5jvr B:

Lineage for d5jvrb_ (5jvr B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
   dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices

4. Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family)

5. Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
   Pfam PF03271

6. Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140615] (14 PDB entries)
   Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254

8. Domain d5jvrb_: 5jvr B: [414990]
   Other proteins in same PDB: d5jvrf2
   automated match to d5jx1a_

Details for d5jvrb_

PDB Entry: 5jvr, 2.1 Å

PDB Description: the neck-linker of mus musculus kif3a fused to the alpha 7 helix of drosophila melanogaster kinesin-1 fused to eb1

PDB Compounds: (B:) Chimera protein of mouse KIF3A,fruit fly Kinesin-1 and human EB1

SCOPe Domain Sequences for d5jvrb_:

Sequence, based on SEQRES records:

>d5jvrb_ a.245.1.1 (B:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
kdalaeewkrryekekekvedlekerdfyfgklrnielicqenegendpvlqrivdilya
tdegf

Sequence, based on observed residues (ATOM records):

>d5jvrb_ a.245.1.1 (B:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
kdalaeewkrryekekekvedlekerdfyfgklrnielicqengendpvlqrivdilyat
degf

Timeline for d5jvrb_:

• d5jvrb_ is new in SCOPe 2.08-stable