Lineage for d5jvrf1 (5jvr F:3-75)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738143Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 2738144Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 2738145Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
    Pfam PF03271
  6. 2738146Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (2 species)
  7. 2738147Species Human (Homo sapiens) [TaxId:9606] [140615] (14 PDB entries)
    Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254
  8. 2738174Domain d5jvrf1: 5jvr F:3-75 [414994]
    Other proteins in same PDB: d5jvrf2
    automated match to d5jx1a_

Details for d5jvrf1

PDB Entry: 5jvr (more details), 2.1 Å

PDB Description: the neck-linker of mus musculus kif3a fused to the alpha 7 helix of drosophila melanogaster kinesin-1 fused to eb1
PDB Compounds: (F:) Chimera protein of mouse KIF3A,fruit fly Kinesin-1 and human EB1

SCOPe Domain Sequences for d5jvrf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jvrf1 a.245.1.1 (F:3-75) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
nedpkdalaeewkrryekekekvedlekerdfyfgklrnielicqenegendpvlqrivd
ilyatdegfvipd

SCOPe Domain Coordinates for d5jvrf1:

Click to download the PDB-style file with coordinates for d5jvrf1.
(The format of our PDB-style files is described here.)

Timeline for d5jvrf1:

  • d5jvrf1 is new in SCOPe 2.08-stable