Lineage for d1clia2 (1cli A:171-345)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216893Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2216894Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2216895Family d.139.1.1: PurM C-terminal domain-like [56043] (7 proteins)
  6. 2216896Protein Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain [56044] (2 species)
  7. 2216897Species Escherichia coli [TaxId:562] [56045] (1 PDB entry)
  8. 2216898Domain d1clia2: 1cli A:171-345 [41459]
    Other proteins in same PDB: d1clia1, d1clib1, d1clic1, d1clid1
    complexed with so4

Details for d1clia2

PDB Entry: 1cli (more details), 2.5 Å

PDB Description: x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution
PDB Compounds: (A:) protein (phosphoribosyl-aminoimidazole synthetase)

SCOPe Domain Sequences for d1clia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clia2 d.139.1.1 (A:171-345) Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain {Escherichia coli [TaxId: 562]}
dgskvsdgdvlialgssgphsngyslvrkilevsgcdpqtteldgkpladhllaptriyv
ksvleliekvdvhaiahltgggfweniprvlpdntqavidesswqwpevfnwlqtagnve
hhemyrtfncgvgmiialpapevdkalallnangenawkigiikasdseqrvvie

SCOPe Domain Coordinates for d1clia2:

Click to download the PDB-style file with coordinates for d1clia2.
(The format of our PDB-style files is described here.)

Timeline for d1clia2: