SCOP 1.63: Domain d1clia2: 1cli A:171-345

Lineage for d1clia2 (1cli A:171-345)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.139: Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain [56042] (1 family)

5. Family d.139.1.1: Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain [56043] (1 protein)

6. Protein Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain [56044] (1 species)

7. Species Escherichia coli [TaxId:562] [56045] (1 PDB entry)

8. Domain d1clia2: 1cli A:171-345 [41459]
   Other proteins in same PDB: d1clia1, d1clib1, d1clic1, d1clid1

Details for d1clia2

PDB Entry: 1cli, 2.5 Å

PDB Description: x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution

SCOP Domain Sequences for d1clia2:

Sequence; same for both SEQRES and ATOM records:

>d1clia2 d.139.1.1 (A:171-345) Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain {Escherichia coli}
dgskvsdgdvlialgssgphsngyslvrkilevsgcdpqtteldgkpladhllaptriyv
ksvleliekvdvhaiahltgggfweniprvlpdntqavidesswqwpevfnwlqtagnve
hhemyrtfncgvgmiialpapevdkalallnangenawkigiikasdseqrvvie

Timeline for d1clia2:

• d1clia2 first appeared (with stable ids) in SCOP 1.55
  
• d1clia2 appears in SCOP 1.61
  
• d1clia2 appears in SCOP 1.65
  
• d1clia2 appears in the current release, SCOPe 2.08