Lineage for d2aop_4 (2aop 426-570)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137732Fold d.134: Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 [56013] (1 superfamily)
  4. 137733Superfamily d.134.1: Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 [56014] (1 family) (S)
  5. 137734Family d.134.1.1: Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 [56015] (1 protein)
  6. 137735Protein Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 [56016] (1 species)
  7. 137736Species Escherichia coli [TaxId:562] [56017] (12 PDB entries)
  8. 137740Domain d2aop_4: 2aop 426-570 [41428]
    Other proteins in same PDB: d2aop_1, d2aop_2

Details for d2aop_4

PDB Entry: 2aop (more details), 1.75 Å

PDB Description: sulfite reductase: reduced with crii edta, siroheme feii, [4fe-4s] +1, phosphate bound

SCOP Domain Sequences for d2aop_4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aop_4 d.134.1.1 (426-570) Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 {Escherichia coli}
pqrensmacvsfptcplamaeaerflpsfidnidnlmakhgvsdehivmrvtgcpngcgr
amlaevglvgkapgrynlhlggnrigtriprmykenitepeilasldeligrwakereag
egfgdftvragiirpvldpardlwd

SCOP Domain Coordinates for d2aop_4:

Click to download the PDB-style file with coordinates for d2aop_4.
(The format of our PDB-style files is described here.)

Timeline for d2aop_4: