Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.58: Ferredoxin-like [54861] (39 superfamilies) |
Superfamily d.58.36: Sulfite reductase, domains 1 and 3 [55124] (1 family) |
Family d.58.36.1: Sulfite reductase, domains 1 and 3 [55125] (1 protein) |
Protein Sulfite reductase, domains 1 and 3 [55126] (1 species) |
Species Escherichia coli [TaxId:562] [55127] (12 PDB entries) |
Domain d2aop_1: 2aop 81-145 [39503] Other proteins in same PDB: d2aop_3, d2aop_4 |
PDB Entry: 2aop (more details), 1.75 Å
SCOP Domain Sequences for d2aop_1:
Sequence, based on SEQRES records: (download)
>d2aop_1 d.58.36.1 (81-145) Sulfite reductase, domains 1 and 3 {Escherichia coli} llrcrlpggvittkqwqaidkfagentiygsirltnrqtfqfhgilkknvkpvhqmlhsv gldal
>d2aop_1 d.58.36.1 (81-145) Sulfite reductase, domains 1 and 3 {Escherichia coli} llrcrlpggvittkqwqaidkfagentiygsirltnrqtfqfhgilpvhqmlhsvgldal
Timeline for d2aop_1: