| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (2 families) ![]() |
| Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins) duplication: consists of two domains of this fold |
| Protein Prolifirating cell nuclear antigen (PCNA) [55989] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55991] (1 PDB entry) |
| Domain d1axce1: 1axc E:1-126 [41396] |
PDB Entry: 1axc (more details), 2.6 Å
SCOP Domain Sequences for d1axce1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1axce1 d.131.1.2 (E:1-126) Prolifirating cell nuclear antigen (PCNA) {Human (Homo sapiens)}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql
Timeline for d1axce1:
View in 3DDomains from other chains: (mouse over for more information) d1axca1, d1axca2, d1axcc1, d1axcc2 |