Lineage for d1axce1 (1axc E:1-126)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262319Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 262320Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 262339Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins)
    duplication: consists of two domains of this fold
  6. 262361Protein Prolifirating cell nuclear antigen (PCNA) [55989] (3 species)
  7. 262372Species Human (Homo sapiens) [TaxId:9606] [55991] (1 PDB entry)
  8. 262377Domain d1axce1: 1axc E:1-126 [41396]

Details for d1axce1

PDB Entry: 1axc (more details), 2.6 Å

PDB Description: human pcna

SCOP Domain Sequences for d1axce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axce1 d.131.1.2 (E:1-126) Prolifirating cell nuclear antigen (PCNA) {Human (Homo sapiens)}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

SCOP Domain Coordinates for d1axce1:

Click to download the PDB-style file with coordinates for d1axce1.
(The format of our PDB-style files is described here.)

Timeline for d1axce1: