SCOP 1.59: Domain d1dmle2: 1dml E:170-319

Lineage for d1dmle2 (1dml E:170-319)

Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
Fold d.131: DNA clamp [55978] (1 superfamily)
Superfamily d.131.1: DNA clamp [55979] (2 families)
Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins)
Protein UL42 [55987] (1 species)
Species Human herpes virus type 1 [55988] (1 PDB entry)
Domain d1dmle2: 1dml E:170-319 [41385]

Details for d1dmle2

PDB Entry: 1dml (more details), 2.7 Å

PDB Description: crystal structure of herpes simplex ul42 bound to the c-terminus of hsv pol

SCOP Domain Sequences for d1dmle2:

Sequence, based on SEQRES records: (download)

>d1dmle2 d.131.1.2 (E:170-319) UL42 {Human herpes virus type 1}
pqgtpdvqlrltrpqltkvlnatgadsatpttfelgvngkfsvfttstcvtfaareegvs
sststqvqilsnaltkagqaaanaktvygenthrtfsvvvddcsmravlrrlqvgggtlk
fflttpvpslcvtatgpnavsavfllkpqk

Sequence, based on observed residues (ATOM records): (download)

>d1dmle2 d.131.1.2 (E:170-319) UL42 {Human herpes virus type 1}
pqgtpdvqlrltrpqltkvlnatgadsatpttfelgvngkfsvfttstcvtfaareegvs
sststnaktvygenthrtfsvvvddcsmravlrrlqvgggtlkfflttpvpslcvtatgp
navsavfllkpqk

SCOP Domain Coordinates for d1dmle2:

Click to download the PDB-style file with coordinates for d1dmle2.
(The format of our PDB-style files is described here.)

Timeline for d1dmle2: