Lineage for d1dmla1 (1dml A:29-169)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137632Fold d.131: DNA clamp [55978] (1 superfamily)
  4. 137633Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 137652Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins)
  6. 137690Protein UL42 [55987] (1 species)
  7. 137691Species Human herpes virus type 1 [55988] (1 PDB entry)
  8. 137692Domain d1dmla1: 1dml A:29-169 [41380]

Details for d1dmla1

PDB Entry: 1dml (more details), 2.7 Å

PDB Description: crystal structure of herpes simplex ul42 bound to the c-terminus of hsv pol

SCOP Domain Sequences for d1dmla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dmla1 d.131.1.2 (A:29-169) UL42 {Human herpes virus type 1}
apcqvvlqgaelngilqafaplrtslldsllvmgdrgilihntifgeqvflplehsqfsr
yrwrgptaaflslvdqkrsllsvfranqypdlrrvelaitgqapfrtlvqriwtttsdge
avelasetlmkreltsfvvlv

SCOP Domain Coordinates for d1dmla1:

Click to download the PDB-style file with coordinates for d1dmla1.
(The format of our PDB-style files is described here.)

Timeline for d1dmla1: