Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) |
Superfamily d.131.1: DNA clamp [55979] (2 families) |
Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins) |
Protein gp45 sliding clamp [55984] (2 species) |
Species Bacteriophage RB69 [TaxId:12353] [55985] (2 PDB entries) |
Domain d1b8hc1: 1b8h C:1-110 [41372] |
PDB Entry: 1b8h (more details), 3 Å
SCOP Domain Sequences for d1b8hc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8hc1 d.131.1.2 (C:1-110) gp45 sliding clamp {Bacteriophage RB69} mklskdtiailknfasinsgillsqgkfimtravngttyaeanisdeidfdvalydlnsf lsilslvsddaeismhtdgnikiadtrstvywpaadkstivfpnkpiqfp
Timeline for d1b8hc1:
View in 3D Domains from other chains: (mouse over for more information) d1b8ha1, d1b8ha2, d1b8hb1, d1b8hb2 |