| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
| Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
| Protein gp45 sliding clamp [55984] (2 species) |
| Species Bacteriophage RB69 [TaxId:12353] [55985] (2 PDB entries) |
| Domain d1b8hc1: 1b8h C:1-110 [41372] |
PDB Entry: 1b8h (more details), 3 Å
SCOPe Domain Sequences for d1b8hc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8hc1 d.131.1.2 (C:1-110) gp45 sliding clamp {Bacteriophage RB69 [TaxId: 12353]}
mklskdtiailknfasinsgillsqgkfimtravngttyaeanisdeidfdvalydlnsf
lsilslvsddaeismhtdgnikiadtrstvywpaadkstivfpnkpiqfp
Timeline for d1b8hc1:
View in 3DDomains from other chains: (mouse over for more information) d1b8ha1, d1b8ha2, d1b8hb1, d1b8hb2 |