PDB entry 1b8h

View 1b8h on RCSB PDB site
Description: sliding clamp, DNA polymerase
Class: transferase
Keywords: sliding clamp, gp45, replisome, accessory protein, transferase
Deposited on 1999-02-01, released 1999-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.265
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase processivity component
    Species: Enterobacteria phage RB69 [TaxId:12353]
    Gene: GENE 45
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b8ha1, d1b8ha2
  • Chain 'B':
    Compound: DNA polymerase processivity component
    Species: Enterobacteria phage RB69 [TaxId:12353]
    Gene: GENE 45
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b8hb1, d1b8hb2
  • Chain 'C':
    Compound: DNA polymerase processivity component
    Species: Enterobacteria phage RB69 [TaxId:12353]
    Gene: GENE 45
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b8hc1, d1b8hc2
  • Chain 'D':
    Compound: DNA POLYMERASE fragment
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8hA (A:)
    mklskdtiailknfasinsgillsqgkfimtravngttyaeanisdeidfdvalydlnsf
    lsilslvsddaeismhtdgnikiadtrstvywpaadkstivfpnkpiqfpvasviteika
    edlqqllrvsrglqidtiaitnkdgkivingynkvedsgltrpkysltltdydgsnnfnf
    vinmanmkiqpgnykvmlwgagdkvaakfessqvsyviameadsthdf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8hB (B:)
    mklskdtiailknfasinsgillsqgkfimtravngttyaeanisdeidfdvalydlnsf
    lsilslvsddaeismhtdgnikiadtrstvywpaadkstivfpnkpiqfpvasviteika
    edlqqllrvsrglqidtiaitnkdgkivingynkvedsgltrpkysltltdydgsnnfnf
    vinmanmkiqpgnykvmlwgagdkvaakfessqvsyviameadsthdf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8hC (C:)
    mklskdtiailknfasinsgillsqgkfimtravngttyaeanisdeidfdvalydlnsf
    lsilslvsddaeismhtdgnikiadtrstvywpaadkstivfpnkpiqfpvasviteika
    edlqqllrvsrglqidtiaitnkdgkivingynkvedsgltrpkysltltdydgsnnfnf
    vinmanmkiqpgnykvmlwgagdkvaakfessqvsyviameadsthdf
    

  • Chain 'D':
    No sequence available.