Lineage for d1b8ha1 (1b8h A:1-110)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84022Fold d.131: DNA clamp [55978] (1 superfamily)
  4. 84023Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 84036Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins)
  6. 84037Protein gp45 sliding clamp [55984] (2 species)
  7. 84038Species Bacteriophage RB69 [TaxId:12353] [55985] (2 PDB entries)
  8. 84045Domain d1b8ha1: 1b8h A:1-110 [41368]

Details for d1b8ha1

PDB Entry: 1b8h (more details), 3 Å

PDB Description: sliding clamp, dna polymerase

SCOP Domain Sequences for d1b8ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8ha1 d.131.1.2 (A:1-110) gp45 sliding clamp {Bacteriophage RB69}
mklskdtiailknfasinsgillsqgkfimtravngttyaeanisdeidfdvalydlnsf
lsilslvsddaeismhtdgnikiadtrstvywpaadkstivfpnkpiqfp

SCOP Domain Coordinates for d1b8ha1:

Click to download the PDB-style file with coordinates for d1b8ha1.
(The format of our PDB-style files is described here.)

Timeline for d1b8ha1: