Lineage for d1b77a1 (1b77 A:1-110)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611115Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 611116Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 611157Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
    duplication: consists of two domains of this fold
  6. 611158Protein gp45 sliding clamp [55984] (2 species)
  7. 611159Species Bacteriophage RB69 [TaxId:12353] [55985] (2 PDB entries)
  8. 611160Domain d1b77a1: 1b77 A:1-110 [41362]

Details for d1b77a1

PDB Entry: 1b77 (more details), 2.1 Å

PDB Description: building a replisome structure from interacting pieces: a sliding clamp complexed with an interaction peptide from dna polymerase

SCOP Domain Sequences for d1b77a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b77a1 d.131.1.2 (A:1-110) gp45 sliding clamp {Bacteriophage RB69}
mklskdtiailknfasinsgillsqgkfimtravngttyaeanisdeidfdvalydlnsf
lsilslvsddaeismhtdgnikiadtrstvywpaadkstivfpnkpiqfp

SCOP Domain Coordinates for d1b77a1:

Click to download the PDB-style file with coordinates for d1b77a1.
(The format of our PDB-style files is described here.)

Timeline for d1b77a1: