![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (2 families) ![]() |
![]() | Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins) duplication: consists of two domains of this fold |
![]() | Protein gp45 sliding clamp [55984] (2 species) |
![]() | Species Bacteriophage RB69 [TaxId:12353] [55985] (2 PDB entries) |
![]() | Domain d1b77a1: 1b77 A:1-110 [41362] |
PDB Entry: 1b77 (more details), 2.1 Å
SCOP Domain Sequences for d1b77a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b77a1 d.131.1.2 (A:1-110) gp45 sliding clamp {Bacteriophage RB69} mklskdtiailknfasinsgillsqgkfimtravngttyaeanisdeidfdvalydlnsf lsilslvsddaeismhtdgnikiadtrstvywpaadkstivfpnkpiqfp
Timeline for d1b77a1:
![]() Domains from other chains: (mouse over for more information) d1b77b1, d1b77b2, d1b77c1, d1b77c2 |