Lineage for d1b77a1 (1b77 A:1-110)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. Protein gp45 sliding clamp [55984] (2 species)
  7. Species Bacteriophage RB69 [TaxId:12353] [55985] (2 PDB entries)
  8. Domain d1b77a1: 1b77 A:1-110 [41362]
    protein/DNA complex

Details for d1b77a1

PDB Entry: 1b77 (more details), 2.1 Å

PDB Description: building a replisome structure from interacting pieces: a sliding clamp complexed with an interaction peptide from dna polymerase
PDB Compounds: (A:) protein (sliding clamp)

SCOPe Domain Sequences for d1b77a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b77a1 d.131.1.2 (A:1-110) gp45 sliding clamp {Bacteriophage RB69 [TaxId: 12353]}
mklskdtiailknfasinsgillsqgkfimtravngttyaeanisdeidfdvalydlnsf
lsilslvsddaeismhtdgnikiadtrstvywpaadkstivfpnkpiqfp

SCOPe Domain Coordinates for d1b77a1 are not available.

Timeline for d1b77a1:

Domains from same chain:
(mouse over for more information)
d1b77a2
Domains from other chains:
(mouse over for more information)
d1b77b1, d1b77b2, d1b77c1, d1b77c2