SCOPe 2.07: Domain d1fugb2: 1fug B:103-231

Lineage for d1fugb2 (1fug B:103-231)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins)

6. Protein S-adenosylmethionine synthetase [55975] (3 species)
   synonym: methionine adenosyltransferase, MAT

7. Species Escherichia coli [TaxId:562] [55976] (9 PDB entries)

8. Domain d1fugb2: 1fug B:103-231 [41348]

Details for d1fugb2

PDB Entry: 1fug, 3.2 Å

PDB Description: s-adenosylmethionine synthetase

PDB Compounds: (B:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d1fugb2:

Sequence; same for both SEQRES and ATOM records:

>d1fugb2 d.130.1.1 (B:103-231) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]}
nqgvdradpleqgagdqglmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrp
daksqvtfqyddgkivgidavvlstqhseeidqkslqeavmeeiikpilpaewltsatkf
finptgrfv

Timeline for d1fugb2:

• d1fugb2 first appeared (with stable ids) in SCOP 1.55
  
• d1fugb2 appears in SCOPe 2.06
  
• d1fugb2 appears in the current release, SCOPe 2.08