Lineage for d3i92b_ (3i92 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868076Species Escherichia coli [TaxId:562] [419849] (3 PDB entries)
  8. 2868084Domain d3i92b_: 3i92 B: [413231]
    automated match to d3hyra_
    complexed with gcp, mg

Details for d3i92b_

PDB Entry: 3i92 (more details), 3 Å

PDB Description: structure of the cytosolic domain of e. coli feob, gppch2p-bound form
PDB Compounds: (B:) Ferrous iron transport protein B

SCOPe Domain Sequences for d3i92b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i92b_ c.37.1.8 (B:) automated matches {Escherichia coli [TaxId: 562]}
kkltiglignpnsgkttlfnqltgsrqrvgnwagvtverkegqfsttdhqvtlvdlpgty
slttissqtsldeqiachyilsgdadllinvvdasnlernlyltlqllelgipcivalnm
ldiaekqnirieidalsarlgcpviplvstrgrgiealklaidrykanenvelvhyaqpl
lneadslakvmpsdiplkqrrwlglqmlegdiysrayageasqhldaalarlrnemddpa
lhiadaryqciaaicdvvsn

SCOPe Domain Coordinates for d3i92b_:

Click to download the PDB-style file with coordinates for d3i92b_.
(The format of our PDB-style files is described here.)

Timeline for d3i92b_:

  • d3i92b_ is new in SCOPe 2.08-stable