Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (37 species) not a true protein |
Species Escherichia coli [TaxId:562] [419849] (3 PDB entries) |
Domain d3i92b_: 3i92 B: [413231] automated match to d3hyra_ complexed with gcp, mg |
PDB Entry: 3i92 (more details), 3 Å
SCOPe Domain Sequences for d3i92b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i92b_ c.37.1.8 (B:) automated matches {Escherichia coli [TaxId: 562]} kkltiglignpnsgkttlfnqltgsrqrvgnwagvtverkegqfsttdhqvtlvdlpgty slttissqtsldeqiachyilsgdadllinvvdasnlernlyltlqllelgipcivalnm ldiaekqnirieidalsarlgcpviplvstrgrgiealklaidrykanenvelvhyaqpl lneadslakvmpsdiplkqrrwlglqmlegdiysrayageasqhldaalarlrnemddpa lhiadaryqciaaicdvvsn
Timeline for d3i92b_: