SCOP 1.73: Domain d1btva_: 1btv A:

Lineage for d1btva_ (1btv A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.129: TBP-like [55944] (10 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (7 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (4 proteins)

6. Protein Major tree pollen allergen [55963] (4 species)

7. Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (5 PDB entries)

8. Domain d1btva_: 1btv A: [41315]

Details for d1btva_

PDB Entry: 1btv

PDB Description: structure of bet v 1, nmr, 20 structures

PDB Compounds: (A:) bet v 1

SCOP Domain Sequences for d1btva_:

Sequence; same for both SEQRES and ATOM records:

>d1btva_ d.129.3.1 (A:) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1 [TaxId: 3505]}
gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
htkgdhevkaeqvkaskemgetllravesyllahsdayn

Timeline for d1btva_:

• d1btva_ first appeared (with stable ids) in SCOP 1.55, called d1btv__
  
• d1btva_ was called d1btv__ in SCOP 1.71
  
• d1btva_ appears in SCOP 1.75
  
• d1btva_ appears in the current release, SCOPe 2.08