SCOP 1.71: Domain d1btv__: 1btv -

Lineage for d1btv__ (1btv -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.129: TBP-like [55944] (9 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (6 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (3 proteins)

6. Protein Major tree pollen allergen [55963] (4 species)

7. Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (5 PDB entries)

8. Domain d1btv__: 1btv - [41315]

Details for d1btv__

PDB Entry: 1btv

PDB Description: structure of bet v 1, nmr, 20 structures

SCOP Domain Sequences for d1btv__:

Sequence; same for both SEQRES and ATOM records:

>d1btv__ d.129.3.1 (-) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1}
gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
htkgdhevkaeqvkaskemgetllravesyllahsdayn

Timeline for d1btv__:

• d1btv__ first appeared (with stable ids) in SCOP 1.55
  
• d1btv__ appears in SCOP 1.69
  
• d1btv__ is called d1btva_ in SCOP 1.73
  
• d1btv__ appears in the current release, SCOPe 2.08, called d1btva_