Lineage for d1btv__ (1btv -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35720Fold d.129: TBP-like [55944] (3 superfamilies)
  4. 35838Superfamily d.129.3: Bet v1-like [55961] (3 families) (S)
  5. 35839Family d.129.3.1: Major birch pollen allergen Bet v 1 [55962] (1 protein)
  6. 35840Protein Major birch pollen allergen Bet v 1 [55963] (2 species)
  7. 35846Species White birch (Betula verrucosa) [TaxId:3505] [55964] (4 PDB entries)
  8. 35849Domain d1btv__: 1btv - [41315]

Details for d1btv__

PDB Entry: 1btv (more details)

PDB Description: structure of bet v 1, nmr, 20 structures

SCOP Domain Sequences for d1btv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1btv__ d.129.3.1 (-) Major birch pollen allergen Bet v 1 {White birch (Betula verrucosa)}
gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
htkgdhevkaeqvkaskemgetllravesyllahsdayn

SCOP Domain Coordinates for d1btv__:

Click to download the PDB-style file with coordinates for d1btv__.
(The format of our PDB-style files is described here.)

Timeline for d1btv__: