Lineage for d1btv__ (1btv -)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.129: TBP-like [55944] (4 superfamilies) 
Superfamily d.129.3: Bet v1-like [55961] (4 families) 
Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (2 proteins) 
Protein Major tree pollen allergen [55963] (3 species) Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (4 PDB entries) 
Domain d1btv__: 1btv - [41315]
Details for d1btv__
PDB Entry: 1btv (more details)
PDB Description: structure of bet v 1, nmr, 20 structures
SCOP Domain Sequences for d1btv__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1btv__ d.129.3.1 (-) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1}
gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
htkgdhevkaeqvkaskemgetllravesyllahsdayn
SCOP Domain Coordinates for d1btv__:
Click to download the PDB-style file with coordinates for d1btv__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1btv__:
- d1btv__ first appeared (with stable ids) in SCOP 1.55
- d1btv__ appears in SCOP 1.59
- d1btv__ appears in SCOP 1.63
- d1btv__ appears in the current release, SCOPe 2.08, called d1btva_
View in 3D