Lineage for d3b3fa_ (3b3f A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892965Family c.66.1.6: Arginine methyltransferase [53351] (5 proteins)
    lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain
  6. 2892996Protein automated matches [254715] (3 species)
    not a true protein
  7. 2893076Species Norway rat (Rattus norvegicus) [TaxId:10116] [256031] (3 PDB entries)
  8. 2893077Domain d3b3fa_: 3b3f A: [413066]
    automated match to d2v7ea_
    protein/RNA complex; complexed with sah

Details for d3b3fa_

PDB Entry: 3b3f (more details), 2.2 Å

PDB Description: The 2.2 A crystal structure of the catalytic domain of coactivator-associated arginine methyl transferase I(CARM1,142-478), in complex with S-adenosyl homocysteine
PDB Compounds: (A:) histone-arginine methyltransferase carm1

SCOPe Domain Sequences for d3b3fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b3fa_ c.66.1.6 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
teessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcgsgilsf
faaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdiiisepmg
ymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwyqpsfhg
vdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipfkfhmlh
sglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtlsgtcll
iankrqsydisivaqvdqtgskssnlldlknpffryt

SCOPe Domain Coordinates for d3b3fa_:

Click to download the PDB-style file with coordinates for d3b3fa_.
(The format of our PDB-style files is described here.)

Timeline for d3b3fa_:

  • d3b3fa_ is new in SCOPe 2.08-stable