SCOP 1.65: Domain d1ebma2: 1ebm A:9-135

Lineage for d1ebma2 (1ebm A:9-135)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.129: TBP-like [55944] (4 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families)

5. Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins)
   contains a single copy of this fold

6. Protein 8-oxoguanine glycosylase [55955] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55956] (10 PDB entries)

8. Domain d1ebma2: 1ebm A:9-135 [41300]
   Other proteins in same PDB: d1ebma1
   complexed with ca, oxo; mutant

Details for d1ebma2

PDB Entry: 1ebm, 2.1 Å

PDB Description: crystal structure of the human 8-oxoguanine glycosylase (hogg1) bound to a substrate oligonucleotide

SCOP Domain Sequences for d1ebma2:

Sequence, based on SEQRES records:

>d1ebma2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens)}
gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
gvrllrq

Sequence, based on observed residues (ATOM records):

>d1ebma2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens)}
gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

Timeline for d1ebma2:

• d1ebma2 first appeared (with stable ids) in SCOP 1.55
  
• d1ebma2 appears in SCOP 1.63
  
• d1ebma2 appears in SCOP 1.67
  
• d1ebma2 appears in the current release, SCOPe 2.08