Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.129: TBP-like [55944] (7 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) |
Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins) contains a single copy of this fold |
Protein 8-oxoguanine glycosylase [55955] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55956] (12 PDB entries) |
Domain d1ebma2: 1ebm A:9-135 [41300] Other proteins in same PDB: d1ebma1 complexed with ca, oxo; mutant |
PDB Entry: 1ebm (more details), 2.1 Å
SCOP Domain Sequences for d1ebma2:
Sequence, based on SEQRES records: (download)
>d1ebma2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens)} gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq gvrllrq
>d1ebma2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens)} gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr llrq
Timeline for d1ebma2: