SCOP 1.65: Domain d1ebma1: 1ebm A:136-325

Lineage for d1ebma1 (1ebm A:136-325)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (4 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins)

6. Protein 8-oxoguanine glycosylase [48160] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48161] (10 PDB entries)

8. Domain d1ebma1: 1ebm A:136-325 [18751]
   Other proteins in same PDB: d1ebma2
   complexed with ca, oxo; mutant

Details for d1ebma1

PDB Entry: 1ebm, 2.1 Å

PDB Description: crystal structure of the human 8-oxoguanine glycosylase (hogg1) bound to a substrate oligonucleotide

SCOP Domain Sequences for d1ebma1:

Sequence; same for both SEQRES and ATOM records:

>d1ebma1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens)}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtqvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadlrq

Timeline for d1ebma1:

• d1ebma1 first appeared (with stable ids) in SCOP 1.55
  
• d1ebma1 appears in SCOP 1.63
  
• d1ebma1 appears in SCOP 1.67
  
• d1ebma1 appears in the current release, SCOPe 2.08