Lineage for d2wiab_ (2wia B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868656Species Klebsiella pneumoniae [TaxId:573] [419828] (4 PDB entries)
  8. 2868660Domain d2wiab_: 2wia B: [412999]
    automated match to d3hyra_
    complexed with mg

Details for d2wiab_

PDB Entry: 2wia (more details), 2.45 Å

PDB Description: crystal structures of the n-terminal intracellular domain of feob from klebsiella pneumoniae in apo form
PDB Compounds: (B:) Ferrous iron transport protein B

SCOPe Domain Sequences for d2wiab_:

Sequence, based on SEQRES records: (download)

>d2wiab_ c.37.1.8 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
mqkltvglignpnsgkttlfnqltgarqrvgnwagvtverkegifattdhqvtlvdlpgt
yslttissqtsldeqiachyilsgdadmlinvvdasnlernlyltlqllelgipcvvaln
mldiaekqqvrididalaarlgcpviplvstrgrgiealkialdrhqansdlelvhypqp
llreadllaqqmsaqipprqrrwlglqmlegdiysrayagdaadkldialanlsdeiddp
alhiadaryqtiaaicdavs

Sequence, based on observed residues (ATOM records): (download)

>d2wiab_ c.37.1.8 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
mqkltvglignpnsgkttlfnqltgarqrvgnwagvtverkegifattdhqvtlvdlpgt
yslttsldeqiachyilsgdadmlinvvdasnlernlyltlqllelgipcvvalnmldia
ekqqvrididalaarlgcpviplrgrgiealkialdrhqansdlelvhypqpllreadll
aqqmsaqipprqrrwlglqmlegdiysrayagdaadkldialanlsdeiddpalhiadar
yqtiaaicdavs

SCOPe Domain Coordinates for d2wiab_:

Click to download the PDB-style file with coordinates for d2wiab_.
(The format of our PDB-style files is described here.)

Timeline for d2wiab_:

  • d2wiab_ is new in SCOPe 2.08-stable