Lineage for d1pczb2 (1pcz B:93-184)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040331Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1040332Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 1040333Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
  6. 1040334Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 1040379Species Pyrococcus woesei [TaxId:2262] [55951] (3 PDB entries)
  8. 1040387Domain d1pczb2: 1pcz B:93-184 [41295]

Details for d1pczb2

PDB Entry: 1pcz (more details), 2.2 Å

PDB Description: structure of tata-binding protein
PDB Compounds: (B:) tata-binding protein

SCOPe Domain Sequences for d1pczb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pczb2 d.129.1.1 (B:93-184) TATA-box binding protein (TBP), C-terminal domain {Pyrococcus woesei [TaxId: 2262]}
kfkrapqidvqnmvfsgdigrefnldvvaltlpnceyepeqfpgviyrvkepksvillfs
sgkivcsgakseadaweavrkllreldkygll

SCOPe Domain Coordinates for d1pczb2:

Click to download the PDB-style file with coordinates for d1pczb2.
(The format of our PDB-style files is described here.)

Timeline for d1pczb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pczb1