Lineage for d1pczb2 (1pcz B:93-184)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35720Fold d.129: TBP-like [55944] (3 superfamilies)
  4. 35721Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 35722Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
  6. 35723Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)
  7. 35803Species Pyrococcus woesei [TaxId:2262] [55951] (3 PDB entries)
  8. 35811Domain d1pczb2: 1pcz B:93-184 [41295]

Details for d1pczb2

PDB Entry: 1pcz (more details), 2.2 Å

PDB Description: structure of tata-binding protein

SCOP Domain Sequences for d1pczb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pczb2 d.129.1.1 (B:93-184) TATA-box binding protein (TBP), C-terminal domain {Pyrococcus woesei}
kfkrapqidvqnmvfsgdigrefnldvvaltlpnceyepeqfpgviyrvkepksvillfs
sgkivcsgakseadaweavrkllreldkygll

SCOP Domain Coordinates for d1pczb2:

Click to download the PDB-style file with coordinates for d1pczb2.
(The format of our PDB-style files is described here.)

Timeline for d1pczb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pczb1