Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (49 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries) |
Domain d2pswa1: 2psw A:2-155 [412929] Other proteins in same PDB: d2pswa2 automated match to d6yzza_ complexed with coa |
PDB Entry: 2psw (more details), 2.1 Å
SCOPe Domain Sequences for d2pswa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pswa1 d.108.1.0 (A:2-155) automated matches {Human (Homo sapiens) [TaxId: 9606]} kgsrielgdvtphnikqlkrlnqvifpvsyndkfykdvlevgelaklayfndiavgavcc rvdhsqnqkrlyimtlgclapyrrlgigtkmlnhvlnicekdgtfdniylhvqisnesai dfyrkfgfeiietkknyykriepadahvlqknlk
Timeline for d2pswa1: