Lineage for d2pswa1 (2psw A:2-155)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969076Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries)
  8. 2969119Domain d2pswa1: 2psw A:2-155 [412929]
    Other proteins in same PDB: d2pswa2
    automated match to d6yzza_
    complexed with coa

Details for d2pswa1

PDB Entry: 2psw (more details), 2.1 Å

PDB Description: Human MAK3 homolog in complex with CoA
PDB Compounds: (A:) N-acetyltransferase 13

SCOPe Domain Sequences for d2pswa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pswa1 d.108.1.0 (A:2-155) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgsrielgdvtphnikqlkrlnqvifpvsyndkfykdvlevgelaklayfndiavgavcc
rvdhsqnqkrlyimtlgclapyrrlgigtkmlnhvlnicekdgtfdniylhvqisnesai
dfyrkfgfeiietkknyykriepadahvlqknlk

SCOPe Domain Coordinates for d2pswa1:

Click to download the PDB-style file with coordinates for d2pswa1.
(The format of our PDB-style files is described here.)

Timeline for d2pswa1:

  • d2pswa1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d2pswa2