SCOPe 2.08: Domain d2o6sb_: 2o6s B:

Lineage for d2o6sb_ (2o6s B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (14 species)
   not a true protein

7. Species Inshore hagfish (Eptatretus burgeri) [TaxId:7764] [193205] (3 PDB entries)

8. Domain d2o6sb_: 2o6s B: [412899]
   automated match to d5ufca_

Details for d2o6sb_

PDB Entry: 2o6s, 1.5 Å

PDB Description: Structural diversity of the hagfish Variable Lymphocyte Receptors B59

PDB Compounds: (B:) Variable lymphocyte receptor B

SCOPe Domain Sequences for d2o6sb_:

Sequence; same for both SEQRES and ATOM records:

>d2o6sb_ c.10.2.0 (B:) automated matches {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}
cpsrcscsgttvecysqgrtsvptgipaqttyldletnslkslpngvfdeltsltqlylg
gnklqslpngvfnkltsltylnlstnqlqslpngvfdkltqlkelalntnqlqslpdgvf
dkltqlkdlrlyqnqlksvpdgvfdrltslqyiwlhdnpwdctcpgirylsewinkhsgv
vrnsagsvapdsakcsgsgkpvrsiicp

Timeline for d2o6sb_:

• d2o6sb_ is new in SCOPe 2.08-stable