Lineage for d7kzff_ (7kzf F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2823225Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2823226Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)
  6. 2823296Protein automated matches [191200] (13 species)
    not a true protein
  7. 2823324Species Human papillomavirus type 16 [TaxId:333760] [399392] (1 PDB entry)
  8. 2823330Domain d7kzff_: 7kzf F: [412578]
    automated match to d7kzfa_

Details for d7kzff_

PDB Entry: 7kzf (more details), 3.1 Å

PDB Description: high resolution cryo em analysis of hpv16 identifies minor structural protein l2 and describes capsid flexibility
PDB Compounds: (F:) Major capsid protein L1

SCOPe Domain Sequences for d7kzff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kzff_ b.121.6.1 (F:) automated matches {Human papillomavirus type 16 [TaxId: 333760]}
mslwlpseatvylppvpvskvvstdeyvartniyyhagtsrllavghpyfpikkpnnnki
lvpkvsglqyrvfrihlpdpnkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisgh
pllnklddtenasayaanagvdnrecismdykqtqlcligckppigehwgkgspctnvav
npgdcpplelintviqdgdmvdtgfgamdfttlqanksevpldictsickypdyikmvse
pygdslffylrreqmfvrhlfnragavgenvpddlyikgsgstanlassnyfptpsgsmv
tsdaqifnkpywlqraqghnngicwgnqlfvtvvdttrstnmslcaaistsettykntnf
keylrhgeeydlqfifqlckitltadvmtyihsmnstiledwnfglqpppggtledtyrf
vtsqaiacqkhtppapkedplkkytfwevnlkekfsadldqfplgrkfllqaglkakpkf
tlg

SCOPe Domain Coordinates for d7kzff_:

Click to download the PDB-style file with coordinates for d7kzff_.
(The format of our PDB-style files is described here.)

Timeline for d7kzff_:

  • d7kzff_ is new in SCOPe 2.08-stable