Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins) |
Protein automated matches [191200] (13 species) not a true protein |
Species Human papillomavirus type 16 [TaxId:333760] [399392] (1 PDB entry) |
Domain d7kzff_: 7kzf F: [412578] automated match to d7kzfa_ |
PDB Entry: 7kzf (more details), 3.1 Å
SCOPe Domain Sequences for d7kzff_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7kzff_ b.121.6.1 (F:) automated matches {Human papillomavirus type 16 [TaxId: 333760]} mslwlpseatvylppvpvskvvstdeyvartniyyhagtsrllavghpyfpikkpnnnki lvpkvsglqyrvfrihlpdpnkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisgh pllnklddtenasayaanagvdnrecismdykqtqlcligckppigehwgkgspctnvav npgdcpplelintviqdgdmvdtgfgamdfttlqanksevpldictsickypdyikmvse pygdslffylrreqmfvrhlfnragavgenvpddlyikgsgstanlassnyfptpsgsmv tsdaqifnkpywlqraqghnngicwgnqlfvtvvdttrstnmslcaaistsettykntnf keylrhgeeydlqfifqlckitltadvmtyihsmnstiledwnfglqpppggtledtyrf vtsqaiacqkhtppapkedplkkytfwevnlkekfsadldqfplgrkfllqaglkakpkf tlg
Timeline for d7kzff_: