Lineage for d6nmsb_ (6nms B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742830Domain d6nmsb_: 6nms B: [411542]
    Other proteins in same PDB: d6nmsa2, d6nmsc_, d6nmsl2, d6nmss_
    automated match to d6shgh_

Details for d6nmsb_

PDB Entry: 6nms (more details), 2.11 Å

PDB Description: blocking fab 136 anti-sirp-alpha antibody in complex with sirp-alpha variant 1
PDB Compounds: (B:) Fab 136 anti-SIRP-alpha antibody Variable Heavy Chain

SCOPe Domain Sequences for d6nmsb_:

Sequence, based on SEQRES records: (download)

>d6nmsb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvqlvesgggvvrpgeslrlscaasgftfssydmnwvrqapgeglewvslisgsgeiiyy
adsvkgrftisrdnskntlylqmnslraedtavyycakennryrffddwgqgtlvtvssa
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Sequence, based on observed residues (ATOM records): (download)

>d6nmsb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvqlvesgggvvrpgeslrlscaasgftfssydmnwvrqapgeglewvslisgsgeiiyy
adsvkgrftisrdnskntlylqmnslraedtavyycakennryrffddwgqgtlvtvssa
stkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkkvepks

SCOPe Domain Coordinates for d6nmsb_:

Click to download the PDB-style file with coordinates for d6nmsb_.
(The format of our PDB-style files is described here.)

Timeline for d6nmsb_:

  • d6nmsb_ is new in SCOPe 2.08-stable