SCOP 1.63: Domain d4mata_: 4mat A:

Lineage for d4mata_ (4mat A:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Methionine aminopeptidase [55924] (4 species)

7. Species Escherichia coli [TaxId:562] [55925] (9 PDB entries)

8. Domain d4mata_: 4mat A: [41150]
   complexed with na; mutant

Details for d4mata_

PDB Entry: 4mat, 2 Å

PDB Description: e.coli methionine aminopeptidase his79ala mutant

SCOP Domain Sequences for d4mata_:

Sequence; same for both SEQRES and ATOM records:

>d4mata_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli}
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigqgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishdelvprgsle

Timeline for d4mata_:

• d4mata_ first appeared (with stable ids) in SCOP 1.55
  
• d4mata_ appears in SCOP 1.61
  
• d4mata_ appears in SCOP 1.65
  
• d4mata_ appears in the current release, SCOPe 2.08, called d4mata1