Lineage for d2jdw__ (2jdw -)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261872Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 261873Superfamily d.126.1: Pentein [55909] (3 families) (S)
  5. 261881Family d.126.1.2: Amidinotransferase [55914] (2 proteins)
    common fold is elaborated with many active site-forminging insertions
  6. 261882Protein L-arginine: glycine amidinotransferase [55915] (1 species)
  7. 261883Species Human (Homo sapiens) [TaxId:9606] [55916] (11 PDB entries)
  8. 261885Domain d2jdw__: 2jdw - [41130]

Details for d2jdw__

PDB Entry: 2jdw (more details), 2.1 Å

PDB Description: crystal structure and mechanism of l-arginine: glycine amidinotransferase: a mitochondrial enzyme involved in creatine biosynthesis

SCOP Domain Sequences for d2jdw__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jdw__ d.126.1.2 (-) L-arginine: glycine amidinotransferase {Human (Homo sapiens)}
cpvssynewdpleevivgraenacvppftievkantyekywpfyqkqgghyfpkdhlkka
vaeieemcnilktegvtvrrpdpidwslkyktpdfestglysamprdilivvgneiieap
mawrsrffeyrayrsiikdyfhrgakwttapkptmadelynqdypihsvedrhklaaqgk
fvttefepcfdaadfiragrdifaqrsqvtnylgiewmrrhlapdyrvhiisfkdpnpmh
idatfniigpgivlsnpdrpchqidlfkkagwtiitpptpiipddhplwmsskwlsmnvl
mldekrvmvdanevpiqkmfeklgittikvnirnanslgggfhcwtcdvrrrgtlqsyld

SCOP Domain Coordinates for d2jdw__:

Click to download the PDB-style file with coordinates for d2jdw__.
(The format of our PDB-style files is described here.)

Timeline for d2jdw__: