SCOPe 2.06: Domain d1b3qb3: 1b3q B:355-539

Lineage for d1b3qb3 (1b3q B:355-539)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.3: Histidine kinase [55884] (8 proteins)

6. Protein Histidine kinase CheA [55887] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [55888] (8 PDB entries)

8. Domain d1b3qb3: 1b3q B:355-539 [41113]
   Other proteins in same PDB: d1b3qa1, d1b3qa2, d1b3qb1, d1b3qb2
   complexed with hg

Details for d1b3qb3

PDB Entry: 1b3q, 2.6 Å

PDB Description: crystal structure of chea-289, a signal transducing histidine kinase

PDB Compounds: (B:) protein (chemotaxis protein chea)

SCOPe Domain Sequences for d1b3qb3:

Sequence; same for both SEQRES and ATOM records:

>d1b3qb3 d.122.1.3 (B:355-539) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]}
mvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaidhg
iepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglideska
atlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsmgiesekdkgtkvt
irlpl

Timeline for d1b3qb3:

• d1b3qb3 first appeared (with stable ids) in SCOP 1.55
  
• d1b3qb3 appears in SCOPe 2.05
  
• d1b3qb3 appears in SCOPe 2.07
  
• d1b3qb3 appears in the current release, SCOPe 2.08