SCOPe 2.06: Domain d1b3qb1: 1b3q B:293-354

Lineage for d1b3qb1 (1b3q B:293-354)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families)

5. Family a.30.2.1: Homodimeric domain of signal transducing histidine kinase [47385] (4 proteins)

6. Protein Histidine kinase CheA [47388] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [47389] (1 PDB entry)

8. Domain d1b3qb1: 1b3q B:293-354 [16994]
   Other proteins in same PDB: d1b3qa2, d1b3qa3, d1b3qb2, d1b3qb3
   complexed with hg

Details for d1b3qb1

PDB Entry: 1b3q, 2.6 Å

PDB Description: crystal structure of chea-289, a signal transducing histidine kinase

PDB Compounds: (B:) protein (chemotaxis protein chea)

SCOPe Domain Sequences for d1b3qb1:

Sequence; same for both SEQRES and ATOM records:

>d1b3qb1 a.30.2.1 (B:293-354) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]}
sqtvrvdiekldnlmdlmgelviarsriletlkkynikeldeslshlsritldlqnvvmk
ir

Timeline for d1b3qb1:

• d1b3qb1 first appeared (with stable ids) in SCOP 1.55
  
• d1b3qb1 appears in SCOPe 2.05
  
• d1b3qb1 appears in SCOPe 2.07
  
• d1b3qb1 appears in the current release, SCOPe 2.08