Lineage for d6ep5c1 (6ep5 C:8-207)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738537Fold a.265: Fic-like [140930] (1 superfamily)
    multihelical; one central helix is surrounded by seven helices
  4. 2738538Superfamily a.265.1: Fic-like [140931] (1 family) (S)
  5. 2738539Family a.265.1.1: Fic-like [140932] (3 proteins)
    Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix
  6. 2738547Protein automated matches [191277] (4 species)
    not a true protein
  7. 2738548Species Enterococcus faecalis [TaxId:1351] [364433] (7 PDB entries)
  8. 2738551Domain d6ep5c1: 6ep5 C:8-207 [411060]
    Other proteins in same PDB: d6ep5a2, d6ep5c2, d6ep5d2, d6ep5f2
    automated match to d6ep5b_
    complexed with adp

Details for d6ep5c1

PDB Entry: 6ep5 (more details), 1.93 Å

PDB Description: enterococcus faecalis fic protein in complex with adp.
PDB Compounds: (C:) Fic family protein

SCOPe Domain Sequences for d6ep5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ep5c1 a.265.1.1 (C:8-207) automated matches {Enterococcus faecalis [TaxId: 1351]}
mlenklgiinqlelnrveervskenakrlydsgdidrievgtfkglsyihnylfediyef
agkvrsqniskgnfrfapvmyleialehidkmpqrnldeivakyvemniahpfregngra
triwldlilkkelkrvvdwnlinkedylsamerspvkdleikylisnaltdkindreifm
kgidisyyyegyteynvdel

SCOPe Domain Coordinates for d6ep5c1:

Click to download the PDB-style file with coordinates for d6ep5c1.
(The format of our PDB-style files is described here.)

Timeline for d6ep5c1:

  • d6ep5c1 is new in SCOPe 2.08-stable