Class a: All alpha proteins [46456] (290 folds) |
Fold a.265: Fic-like [140930] (1 superfamily) multihelical; one central helix is surrounded by seven helices |
Superfamily a.265.1: Fic-like [140931] (1 family) |
Family a.265.1.1: Fic-like [140932] (3 proteins) Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix |
Protein automated matches [191277] (4 species) not a true protein |
Species Enterococcus faecalis [TaxId:1351] [364433] (7 PDB entries) |
Domain d6ep5c1: 6ep5 C:8-207 [411060] Other proteins in same PDB: d6ep5a2, d6ep5c2, d6ep5d2, d6ep5f2 automated match to d6ep5b_ complexed with adp |
PDB Entry: 6ep5 (more details), 1.93 Å
SCOPe Domain Sequences for d6ep5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ep5c1 a.265.1.1 (C:8-207) automated matches {Enterococcus faecalis [TaxId: 1351]} mlenklgiinqlelnrveervskenakrlydsgdidrievgtfkglsyihnylfediyef agkvrsqniskgnfrfapvmyleialehidkmpqrnldeivakyvemniahpfregngra triwldlilkkelkrvvdwnlinkedylsamerspvkdleikylisnaltdkindreifm kgidisyyyegyteynvdel
Timeline for d6ep5c1: