SCOPe 2.08: Domain d6ep5a1: 6ep5 A:8-207

Lineage for d6ep5a1 (6ep5 A:8-207)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.265: Fic-like [140930] (1 superfamily)
multihelical; one central helix is surrounded by seven helices
Superfamily a.265.1: Fic-like [140931] (1 family)
Family a.265.1.1: Fic-like [140932] (3 proteins)
Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix
Protein automated matches [191277] (4 species)
not a true protein
Species Enterococcus faecalis [TaxId:1351] [364433] (7 PDB entries)
Domain d6ep5a1: 6ep5 A:8-207 [411058]
Other proteins in same PDB: d6ep5a2, d6ep5c2, d6ep5d2, d6ep5f2
automated match to d6ep5b_
complexed with adp

Details for d6ep5a1

PDB Entry: 6ep5 (more details), 1.93 Å

PDB Description: enterococcus faecalis fic protein in complex with adp.

PDB Compounds: (A:) Fic family protein

SCOPe Domain Sequences for d6ep5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ep5a1 a.265.1.1 (A:8-207) automated matches {Enterococcus faecalis [TaxId: 1351]}
mlenklgiinqlelnrveervskenakrlydsgdidrievgtfkglsyihnylfediyef
agkvrsqniskgnfrfapvmyleialehidkmpqrnldeivakyvemniahpfregngra
triwldlilkkelkrvvdwnlinkedylsamerspvkdleikylisnaltdkindreifm
kgidisyyyegyteynvdel

SCOPe Domain Coordinates for d6ep5a1:

Click to download the PDB-style file with coordinates for d6ep5a1.
(The format of our PDB-style files is described here.)

Timeline for d6ep5a1: