Lineage for d6dcvh1 (6dcv H:1-230)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.0: automated matches [191470] (1 protein)
not a true familyProtein automated matches [190740] (31 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) 
Domain d6dcvh1: 6dcv H:1-230 [410976]
Other proteins in same PDB: d6dcva2, d6dcvb2, d6dcvh2, d6dcvl2
automated match to d6shgh_
complexed with gol
Details for d6dcvh1
PDB Entry: 6dcv (more details), 1.9 Å
PDB Description: crystal structure of human anti-tau antibody cbtau-27.1
PDB Compounds: (H:) heavy chain of CBTAU-27.1 FabSCOPe Domain Sequences for d6dcvh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dcvh1 b.1.1.0 (H:1-230) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvesgpemrkpgeslkiscktsgyifsdywtawvrqlpgkglqwmgiiysgdsdtry
hpsvqghvtmstdsslttaylqwsslkasdtgiyycarldarvdagwqldswgqgtlvtv
ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepksc
SCOPe Domain Coordinates for d6dcvh1:
Click to download the PDB-style file with coordinates for d6dcvh1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6dcvh1:
- d6dcvh1 is new in SCOPe 2.08-stable
View in 3D
