PDB entry 6dcv

View 6dcv on RCSB PDB site
Description: Crystal structure of human anti-tau antibody CBTAU-27.1
Class: immune system
Keywords: Tau, Fab, naturally occurring human antibody, common motif, IMMUNE SYSTEM
Deposited on 2018-05-08, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Light chain of CBTAU27.1 Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DCV (0-219)
    Domains in SCOPe 2.07: d6dcva1, d6dcva2
  • Chain 'B':
    Compound: heavy chain of CBTAU-27.1 Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DCV (0-End)
  • Chain 'H':
    Compound: heavy chain of CBTAU-27.1 Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DCV (0-End)
  • Chain 'L':
    Compound: Light chain of CBTAU27.1 Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DCV (0-219)
    Domains in SCOPe 2.07: d6dcvl1, d6dcvl2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dcvA (A:)
    diqltqspdslavslgeratinckssqsvfsrdnnknylawyqhksgqppkllffwassr
    esgvsdrfsgsgsgtdftltidnlqaedvalyycqhyfntphnfgqgtkleikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dcvL (L:)
    diqltqspdslavslgeratinckssqsvfsrdnnknylawyqhksgqppkllffwassr
    esgvsdrfsgsgsgtdftltidnlqaedvalyycqhyfntphnfgqgtkleikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrgec