Lineage for d1soxa2 (1sox A:3-93)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137119Fold d.120: Cytochrome b5 [55855] (1 superfamily)
  4. 137120Superfamily d.120.1: Cytochrome b5 [55856] (1 family) (S)
  5. 137121Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)
  6. 137166Protein Sulfite oxidase, N-terminal domain [55866] (1 species)
  7. 137167Species Chicken (Gallus gallus) [TaxId:9031] [55867] (1 PDB entry)
  8. 137168Domain d1soxa2: 1sox A:3-93 [41090]
    Other proteins in same PDB: d1soxa1, d1soxa3, d1soxb1, d1soxb3

Details for d1soxa2

PDB Entry: 1sox (more details), 1.9 Å

PDB Description: sulfite oxidase from chicken liver

SCOP Domain Sequences for d1soxa2:

Sequence, based on SEQRES records: (download)

>d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus)}
sypeytreevgrhrspeervwvthgtdvfdvtdfvelhpggpdkillaaggalepfwaly
avhgephvlellqqykvgelspdeapaapda

Sequence, based on observed residues (ATOM records): (download)

>d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus)}
sypeytreevgrhrspeervwvthgtdvfdvtdfvelhpggpdkillaaggalepfwaly
avhgephvlellqqykvgelspdeapapda

SCOP Domain Coordinates for d1soxa2:

Click to download the PDB-style file with coordinates for d1soxa2.
(The format of our PDB-style files is described here.)

Timeline for d1soxa2: