SCOPe 2.07: Domain d1ieua_: 1ieu A:

Lineage for d1ieua_ (1ieu A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
   beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)

4. Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families)

5. Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)

6. Protein Cytochrome b5 [55858] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [55860] (20 PDB entries)

8. Domain d1ieua_: 1ieu A: [41083]
   apo form

Details for d1ieua_

PDB Entry: 1ieu

PDB Description: apocytochrome b5, ph 6.2, 298 k, nmr, 10 structures

PDB Compounds: (A:) apocytochrome b5

SCOPe Domain Sequences for d1ieua_:

Sequence; same for both SEQRES and ATOM records:

>d1ieua_ d.120.1.1 (A:) Cytochrome b5 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
vghstdarelsktyiigelhpddrskiakpsetl

Timeline for d1ieua_:

• d1ieua_ first appeared (with stable ids) in SCOP 1.55, called d1ieu__
  
• d1ieua_ appears in SCOPe 2.06
  
• d1ieua_ appears in the current release, SCOPe 2.08