SCOP 1.55: Domain d1ieu__: 1ieu -

Lineage for d1ieu__ (1ieu -)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.120: Cytochrome b5 [55855] (1 superfamily)

4. Superfamily d.120.1: Cytochrome b5 [55856] (1 family)

5. Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)

6. Protein Cytochrome b5 [55858] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [55860] (12 PDB entries)

8. Domain d1ieu__: 1ieu - [41083]

Details for d1ieu__

PDB Entry: 1ieu

PDB Description: apocytochrome b5, ph 6.2, 298 k, nmr, 10 structures

SCOP Domain Sequences for d1ieu__:

Sequence; same for both SEQRES and ATOM records:

>d1ieu__ d.120.1.1 (-) Cytochrome b5 {Rat (Rattus norvegicus)}
dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
vghstdarelsktyiigelhpddrskiakpsetl

Timeline for d1ieu__:

• d1ieu__ appears in SCOP 1.57
  
• d1ieu__ appears in the current release, SCOPe 2.08, called d1ieua_