SCOP 1.63: Domain d1b5b__: 1b5b -

Lineage for d1b5b__ (1b5b -)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.120: Cytochrome b5 [55855] (1 superfamily)
   small, heme-binding fold

4. Superfamily d.120.1: Cytochrome b5 [55856] (1 family)

5. Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)

6. Protein Cytochrome b5 [55858] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [55860] (20 PDB entries)

8. Domain d1b5b__: 1b5b - [41081]
   complexed with hem

Details for d1b5b__

PDB Entry: 1b5b

PDB Description: rat ferrocytochrome b5 b conformation, nmr, 1 structure

SCOP Domain Sequences for d1b5b__:

Sequence; same for both SEQRES and ATOM records:

>d1b5b__ d.120.1.1 (-) Cytochrome b5 {Rat (Rattus norvegicus)}
dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
vghstdarelsktyiigelhpddrskiakpsetl

Timeline for d1b5b__:

• d1b5b__ first appeared (with stable ids) in SCOP 1.55
  
• d1b5b__ appears in SCOP 1.61
  
• d1b5b__ appears in SCOP 1.65
  
• d1b5b__ appears in the current release, SCOPe 2.08, called d1b5ba_