Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.120: Cytochrome b5 [55855] (1 superfamily) |
Superfamily d.120.1: Cytochrome b5 [55856] (1 family) |
Family d.120.1.1: Cytochrome b5 [55857] (4 proteins) |
Protein Cytochrome b5 [55858] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [55859] (7 PDB entries) |
Domain d1wdb__: 1wdb - [41070] |
PDB Entry: 1wdb (more details)
SCOP Domain Sequences for d1wdb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdb__ d.120.1.1 (-) Cytochrome b5 {Cow (Bos taurus)} skavkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfed vghstdarelsktfiigelhpddr
Timeline for d1wdb__: